PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.260500.1
Common NameCsa_3G113280, LOC101216287
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 1005aa    MW: 113685 Da    PI: 7.056
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.260500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.12e-08377422146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r++WTt Ed+ l+  ++q G ++W   a  +g++Rt+ qc sr+q 
   Cucsa.260500.1 377 RDPWTTSEDKSLLFTIQQKGLNNWIEMAVSLGTNRTPFQCLSRYQR 422
                      789*****************************************96 PP

2Myb_DNA-binding41.92.3e-13431474246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        WT+eEd++l  av+ +G ++W ++a+t+  gR + qc +rw k
   Cucsa.260500.1 431 REWTKEEDDRLRSAVATFGVRDWQAVASTLE-GRAGTQCSNRWKK 474
                      68*****************************.***********98 PP

3Myb_DNA-binding33.97.3e-11483528147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g +T++Ed +l+ av ++G+++W++ a+ ++ gR   qc++rw++ 
   Cucsa.260500.1 483 KGYFTPDEDIRLKIAVLLFGPKNWNKKAEFLP-GRNQVQCRERWFNC 528
                      689*****************************.***********996 PP

4Myb_DNA-binding48.71.7e-15535579147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r  WT+eEd++l  a++++G   W+++a++++  Rt+++c+ rw k+
   Cucsa.260500.1 535 RCEWTEEEDLRLEIAIQEHGYS-WAKVAACVP-SRTDNECRRRWKKL 579
                      568*****************99.*********.***********997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500905.448272371IPR017877Myb-like domain
SMARTSM007171.9276373IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-8280295IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.3E-8344384IPR009057Homeodomain-like
SuperFamilySSF466891.98E-15353421IPR009057Homeodomain-like
PROSITE profilePS500909.14372424IPR017877Myb-like domain
SMARTSM007173.5E-4376426IPR001005SANT/Myb domain
PfamPF002497.4E-6377422IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-12385435IPR009057Homeodomain-like
SuperFamilySSF466898.97E-19409479IPR009057Homeodomain-like
PROSITE profilePS5129420.193425480IPR017930Myb domain
SMARTSM007175.4E-11429478IPR001005SANT/Myb domain
CDDcd001671.94E-9432476No hitNo description
PfamPF139215.1E-12433494No hitNo description
Gene3DG3DSA:1.10.10.601.2E-15436482IPR009057Homeodomain-like
SuperFamilySSF466891.52E-24480576IPR009057Homeodomain-like
PROSITE profilePS5129411.598481529IPR017930Myb domain
SMARTSM007172.3E-8482531IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.9E-18485535IPR009057Homeodomain-like
CDDcd001671.54E-7486527No hitNo description
PROSITE profilePS5129423.87530584IPR017930Myb domain
SMARTSM007178.1E-14534582IPR001005SANT/Myb domain
PfamPF002492.7E-14535579IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-17536579IPR009057Homeodomain-like
CDDcd001671.44E-11537580No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1005 aa     Download sequence    Send to blast
MSLRNHVDEI DVEHPADKED GVVDEDMEVL QRAYRLAGVN PEDYINPRLS SPAAGDADPG  60
SDSDDVDDFE LLRDIQNRFS ILADEQPQST PVSADEEEDE FEMLRSIQRR FAAYESDTLS  120
NKPNQSRDYV GSLKLDSDDI AVESQTSSKR PSMLAFEKGS LPKAALAFVD AIKKNRSQQK  180
FIRSKMIHLE ARIEENKKLR KRCKILKDFQ GSCKRRTSCA LSQMIDPRVQ LISAAKPQAK  240
DSSKKDKRLS GMYYGPDENS HVACYRMGLA KFPPVDRKKW SIVERENLGK GIRQQFQEMV  300
LQISVDQISG PQGISGDSDD LDNILASIKD LDIAPDKIRE FLPKVNWDKL ASMYLQGRSG  360
AECEARWLNF EDPLINRDPW TTSEDKSLLF TIQQKGLNNW IEMAVSLGTN RTPFQCLSRY  420
QRSLNASILK REWTKEEDDR LRSAVATFGV RDWQAVASTL EGRAGTQCSN RWKKSLDPAR  480
TRKGYFTPDE DIRLKIAVLL FGPKNWNKKA EFLPGRNQVQ CRERWFNCLD PSLRRCEWTE  540
EEDLRLEIAI QEHGYSWAKV AACVPSRTDN ECRRRWKKLF PDEVPLLQEA RKIQKAALIS  600
NFVDRETERP ALGPADFRPR PNTDSLCNTD GPIPAPKRNV KTRKMPVSRN EKSATGDAPK  660
KRKSNYQRFQ TDATAQVGIA YNTSFVPEEV QSSKPQRKRN RRGAYTAKRI GVPELRSDSE  720
WCAKQNLDTE SLGLQLNSKE SERSNSNCTE TVDENIMEVL ENKVAEKLTE ENACFSEPEK  780
NQNSTGSSGV SVLSEMTNDL VDYNPSILTD TTLFASTTVD DIEELKGKSA ADRDLDDSNS  840
FSLAHSCLEL RTVDSEGVDS YSVDEYTAKS NGVCNPTQGR RKKNSKTSNN SHDNLLIPRQ  900
QIVQETLGTK KPLHHNQSKK RKHSNTGPST LKTSEAVEEV DDCTLVGFLQ KRLKRTAMTH  960
NETVDCSSNA PLKVDNDDNE PTIASFLNKL KRKKHQRPSG DELN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C3e-313495842155MYB PROTO-ONCOGENE PROTEIN
1h89_C3e-313495842155MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1695701QRKRNRR
2909921KKPLHHNQSKKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818580.0LN681858.1 Cucumis melo genomic scaffold, anchoredscaffold00028.
GenBankLN7132600.0LN713260.1 Cucumis melo genomic chromosome, chr_6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011650585.10.0PREDICTED: uncharacterized protein LOC101216287
RefseqXP_011650584.10.0PREDICTED: uncharacterized protein LOC101216287
RefseqXP_011650583.10.0PREDICTED: uncharacterized protein LOC101216287
TrEMBLA0A0A0L2R20.0A0A0A0L2R2_CUCSA; Uncharacterized protein
STRINGPOPTR_0015s04260.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF74413344
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.10.0myb domain protein 4r1
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]